Daily Usenet report

Jul 14 01:00:01 -- Jul 14 15:30:01

Unknown entries from news log file:

First 50 / 95030 lines (0.1%)

Jul 14 01:00:01 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=reader2.newsxs.nl groups=alt.binaries.usenet2day message_id=_iteqcvquvlenofwulylzeodh-1784009892437_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 1840312868/716800"
Jul 14 01:00:01 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=reader2.newsxs.nl groups=alt.binaries.usenet2day message_id=_iteqcvquvlenofwulylzeodh-1784009892437_nyuu_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:02 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.fz message_id=_4f5a743c0cbe40998e65b087411e5ec6_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 168995436/716800"
Jul 14 01:00:02 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.hitnews.com groups=alt.binaries.fz message_id=_4f5a743c0cbe40998e65b087411e5ec6_nyuu_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:02 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=abp002.abavia.com groups=alt.binaries.wtfnzb.mike message_id=_tdjrzoejdrrrrkqwwmsblkes-1784009819914_private_ reason="Malformed yEnc: inconsistent declared sizes 14756227072/716800"
Jul 14 01:00:03 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx03.ams4.posted groups=alt.binaries.backup message_id=_a20c91a0228b4507a29b4e11db84da72_aewo_ reason="Malformed yEnc: inconsistent declared sizes 1953710334/716800"
Jul 14 01:00:03 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=fx03.ams4.posted groups=alt.binaries.backup message_id=_a20c91a0228b4507a29b4e11db84da72_aewo_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:04 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.tv message_id=_lregtscyrdnsnssmfcbgymws-1784010006861_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 1753255974/716800"
Jul 14 01:00:07 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=posting.uzoreto.com groups=alt.binaries.goat message_id=_nfhgqrvscwpswkpprrsgphsyrtdpdyqnhlhlx_jk_tyzdv.gi_r.oblr_ reason="Malformed yEnc: inconsistent declared sizes 200000000/768000"
Jul 14 01:00:08 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.a51_alt.binaries.ath_alt.binaries.frogs_alt.binaries.jph_alt.binaries.pwp message_id=_0ea3b5896f4a47649c710f0a7b37f528_ngpost_ reason="Malformed yEnc: inconsistent declared sizes 67123172/716800"
Jul 14 01:00:09 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx02.ams4.posted groups=alt.binaries.backup message_id=_092735839ee941389f8739551ca820b1_ngpost_ reason="Malformed yEnc: inconsistent declared sizes 16568605252/716800"
Jul 14 01:00:10 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=usenetnews.net groups=alt.binaries.wtfnzb.echo message_id=_sxtfmcijvxpnjrmmdvyalwla-1784010012217_private_ reason="Malformed yEnc: inconsistent declared sizes 250000000/716800"
Jul 14 01:00:10 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=usenetnews.net groups=alt.binaries.wtfnzb.echo message_id=_sxtfmcijvxpnjrmmdvyalwla-1784010012217_private_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:11 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.lima message_id=_bnfzqnczljpfdlsxkvdztzyh-1784009587322_private_ reason="Malformed yEnc: inconsistent declared sizes 5321259008/716800"
Jul 14 01:00:12 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.xylo message_id=_2c8e3855f5354eb585034324dea4b196_ngpost.com_ reason="Malformed yEnc: inconsistent declared sizes 2800746496/716800"
Jul 14 01:00:12 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx13.ams4.posted groups=alt.binaries.storage message_id=_cd4ef4cd19a848afb8111958247fa6f2_ngpost_ reason="Malformed yEnc: inconsistent declared sizes 1048576000/716800"
Jul 14 01:00:12 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=fx13.ams4.posted groups=alt.binaries.storage message_id=_cd4ef4cd19a848afb8111958247fa6f2_ngpost_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:13 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.beta message_id=_seouldggkrdzwwibxjkztibs-1784010242183_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 500000000/716800"
Jul 14 01:00:13 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.boneless_alt.binaries.hdtv.x264_alt.binaries.nl message_id=_ezsmsq0hr9pb2z5x9phu_jbinup.local_ reason="Malformed yEnc: inconsistent declared sizes 150000000/640000"
Jul 14 01:00:20 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx06.ams4.posted groups=alt.binaries.misc_alt.binaries.movie message_id=_tsxdbhisbhnuuakqlgqofmac-1784010312860_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 23651674310/716800"
Jul 14 01:00:20 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.dvd.midnightmovies message_id=_3f7bf800d06346dba5c05c63cf4185e0_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 998244352/716800"
Jul 14 01:00:20 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.hitnews.com groups=alt.binaries.dvd.midnightmovies message_id=_3f7bf800d06346dba5c05c63cf4185e0_nyuu_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:21 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx04.ams4.posted groups=alt.binaries.misc_alt.binaries.movie message_id=_xtktsbnnjrppwnxmncneqhaf-1784009884442_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 42343209489/716800"
Jul 14 01:00:22 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.delta message_id=_qdrnchcbobhzarkanhsvbvak-1784010126273_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 300000000/716800"
Jul 14 01:00:22 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=abp003.abavia.com groups=alt.binaries.wtfnzb.juliet message_id=_qwxhzfaecdjoijapnptswnix-1784009943523_private_ reason="Malformed yEnc: inconsistent declared sizes 14756227072/716800"
Jul 14 01:00:23 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.a51_alt.binaries.ath_alt.binaries.frogs_alt.binaries.jph_alt.binaries.pwp message_id=_cce43b51e760454faa6176d11c1f0677_ngpost_ reason="Malformed yEnc: inconsistent declared sizes 104857600/716800"
Jul 14 01:00:23 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.hitnews.com groups=alt.binaries.a51_alt.binaries.ath_alt.binaries.frogs_alt.binaries.jph_alt.binaries.pwp message_id=_cce43b51e760454faa6176d11c1f0677_ngpost_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:24 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.golf message_id=_zslrcjtzzvuyfmbpmloyhyxt-1784010246411_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 500000000/716800"
Jul 14 01:00:24 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.comp message_id=_9uzknlfrm92.j.w.ruiciqg.tl_jmfaiwurn_a10a74sl4.44npg_ reason="Malformed yEnc: inconsistent declared sizes 492111656/768000"
Jul 14 01:00:24 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.usenet.farm groups=alt.binaries.comp message_id=_9uzknlfrm92.j.w.ruiciqg.tl_jmfaiwurn_a10a74sl4.44npg_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:25 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.dvd.midnightmovies message_id=_329a0bd1a6904077b4b0f854467fc069_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 998244352/716800"
Jul 14 01:00:26 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.cheapnews.eu groups=alt.binaries.multimedia.alias message_id=_tv0f96pzw4hvdgsise7vzc2l_4sfiaaodzskn.5gt_ reason="Malformed yEnc: inconsistent declared sizes 2118989871/716800"
Jul 14 01:00:26 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=abp003.abavia.com groups=alt.binaries.wtfnzb.mike message_id=_zzfrskkfjtvgyesqoknnzaxk-1784010483139_private_ reason="Malformed yEnc: inconsistent declared sizes 7196507795/716800"
Jul 14 01:00:27 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=reader2.newsxs.nl groups=alt.binaries.encrypted message_id=_bab741d904ee4b2a9590b4d6ba023a89_ngpost_ reason="Malformed yEnc: inconsistent declared sizes 354749144/716800"
Jul 14 01:00:27 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=reader2.newsxs.nl groups=alt.binaries.encrypted message_id=_bab741d904ee4b2a9590b4d6ba023a89_ngpost_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:28 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx01.ams4.posted groups=alt.binaries.misc_alt.binaries.movie message_id=_attazmbjjnhnbusqryqfsdvc-1784010418739_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 3774524088/716800"
Jul 14 01:00:28 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=fx01.ams4.posted groups=alt.binaries.misc_alt.binaries.movie message_id=_attazmbjjnhnbusqryqfsdvc-1784010418739_nyuu_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:28 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.hunters message_id=_e2db1d8d27bb43ef9136052580d2a213_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 337013968/716800"
Jul 14 01:00:29 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.lima message_id=_wctkvvwgeuzbctljttzqwvza-1784010049991_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 500000000/716800"
Jul 14 01:00:29 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.cats message_id=_c95cab7d4e7a47b3afc4c4e061c789f8_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 214958080/716800"
Jul 14 01:00:30 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=usenetnews.net groups=alt.binaries.wtfnzb.kilo message_id=_pmtklqmfloeeegrvuwfegcvc-1784010005815_private_ reason="Malformed yEnc: inconsistent declared sizes 250000000/716800"
Jul 14 01:00:30 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=usenetnews.net groups=alt.binaries.wtfnzb.kilo message_id=_pmtklqmfloeeegrvuwfegcvc-1784010005815_private_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:31 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=gru.netnews.com groups=alt.binaries.u4e message_id=_18c213b17c899cb8.19294.31ae7b01c7535e22_hkatfpfgdxwnpx.net_ reason="Malformed yEnc: inconsistent declared sizes 7731463203/768000"
Jul 14 01:00:31 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=gru.netnews.com groups=alt.binaries.u4e message_id=_18c213b17c899cb8.19294.31ae7b01c7535e22_hkatfpfgdxwnpx.net_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:32 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.ftn message_id=_4_0_jzfqvctht.1tdcchlr6p_js0alaq.hq44_ reason="Malformed yEnc: inconsistent declared sizes 492111656/768000"
Jul 14 01:00:32 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.usenet.farm groups=alt.binaries.ftn message_id=_4_0_jzfqvctht.1tdcchlr6p_js0alaq.hq44_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:32 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.cheapnews.eu groups=alt.binaries.sleazemovies message_id=_f0ii1vxxnk8gh1x7fc7uis6z_ygb5t79cxn27.nzz_ reason="Malformed yEnc: inconsistent declared sizes 2131702827/716800"
Jul 14 01:00:33 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=posting.uzoreto.com groups=alt.binaries.encrypted message_id=_ngoa0goa4crr0tmbo6u_075b53610971ea50euvb9bu7q9lbwrh_ reason="Malformed yEnc: inconsistent declared sizes 447741952/768000"
Jul 14 01:00:33 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.bravo message_id=_cxhspwertdznrdfvulpbyqpj-1784010053986_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 300000000/716800"
Jul 14 01:00:33 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.usenet.farm groups=alt.binaries.wtfnzb.bravo message_id=_cxhspwertdznrdfvulpbyqpj-1784010053986_nyuu_ reason="Binary byte profile: nonprintable ratio 11%"

Log entries by program:

Program nameLines%LinesSize%Size
innd 123192 57.6%28.7 MB 62.0%
inn 84914 39.7%16.7 MB 36.1%
innfeed 5094 2.4%820.0 KB 1.7%
nnrpd 496 0.2%88.0 KB 0.2%
nocem 39 0.0%6.2 KB 0.0%
controlchan 13 0.0%2.8 KB 0.0%
overchan 2 0.0%0.2 KB 0.0%
pgpverify 1 0.0%0.3 KB 0.0%
TOTAL: 8 213751 100.0%46.2 MB100.0%

Control commands to innd:

CommandNumber
go 58
logmode 1
mode 90
name 1
pause 59
renumber 1
reserve 2
shutdown 3
TOTAL: 8 215

Control channel:

SendernewgrouprmgroupOtherBad PGPDoItOK
newgroups-request@fido7.org001101
TOTAL001101

Incoming feeds (innd):

ServerConnectsOfferedTakenRefusedReject%AccptElapsed
1newsfeed.bofh.team 2583 71790 20272 575 50943 28%2747:33:41
2feeder.erje.net 17 4839 630 3139 1070 13%34:13:58
3nk-out.news.weretis.net 14 7280 529 5718 1033 7%29:53:32
4news.nntp4.net 12 4766 345 3580 841 7%17:59:10
5news.dne3.net 13 4080 343 3026 711 8%15:08:58
6news.quux.org 9 3436 308 2619 509 8%19:25:34
7news.sonologic.net 8 3887 280 3063 544 7%14:39:39
8newsfeed.endofthelinebbs.com 6 3817 273 2835 709 7%16:21:07
9news.snarked.org 276 3396 241 2644 511 7%58:59:21
10nntp.club.cc.cmu.edu 357 5380 160 4595 625 2%27:53:14
11nk-out.news.chmurka.net 4 1377 92 1112 173 6%17:56:17
12nntp.comgw.net 2 948 85 711 152 8%15:28:24
13news.corradoroberto.it 3 1564 71 1242 251 4%18:09:30
14localhost 40 41 40 0 1 97%00:06:40
15news.trigofacile.com 20 256 12 210 34 4%12:40:01
TOTAL: 15 3364 116857 23681 35069 58107 20%3046:29:06
Articles received by server

Incoming volume (innd):

ServerAcceptVolDupVolRejVolTotalVol%AccVol/Art
1newsfeed.bofh.team13.3 GB441.3 MB37.9 GB51.6 GB 25%759.8 KB
2news.sonologic.net2.8 MB4.4 MB538.4 KB7.7 MB 36%9.6 KB
3news.quux.org2.1 MB5.5 MB256.9 KB7.8 MB 26%9.8 KB
4newsfeed.endofthelinebbs.com1.9 MB6.1 MB1.0 MB9.1 MB 21%9.5 KB
5feeder.erje.net1.6 MB1.8 MB1.7 MB5.1 MB 31%3.1 KB
6news.dne3.net1.5 MB12.2 MB7.7 MB21.5 MB 7%20.9 KB
7news.nntp4.net1.4 MB7.1 MB13.4 MB21.9 MB 6%18.9 KB
8nk-out.news.weretis.net1.3 MB3.1 MB446.0 KB4.9 MB 27%3.2 KB
9nntp.comgw.net1017.7 KB2.5 MB2.5 MB5.9 MB 16%25.6 KB
10news.snarked.org764.1 KB2.0 MB733.9 KB3.5 MB 21%4.7 KB
11nntp.club.cc.cmu.edu428.8 KB1.5 MB473.8 KB2.4 MB 17%3.1 KB
12localhost292.4 KB0.0 KB2.7 KB295.1 KB 99%7.2 KB
13nk-out.news.chmurka.net229.0 KB741.8 KB20.5 KB991.2 KB 23%3.7 KB
14news.corradoroberto.it162.7 KB896.2 KB77.0 KB1.1 MB 14%3.5 KB
15news.trigofacile.com29.9 KB113.9 KB6.1 KB149.9 KB 19%3.3 KB
TOTAL: 1513.3 GB488.9 MB37.9 GB51.7 GB 25%662.8 KB
Incoming volume received by server

Incoming articles (innd):

DateArticles%ArtsArt/secSize%SizeKB/sec
Jul 14 01:00:01 - 01:59:59 1463 6.0% 0.41946.7 MB 6.7% 269.36
Jul 14 02:00:00 - 02:59:59 1530 6.3% 0.42933.6 MB 6.6% 265.55
Jul 14 03:00:00 - 03:59:59 1632 6.7% 0.45989.6 MB 7.0% 281.50
Jul 14 04:00:00 - 04:59:59 1722 7.1% 0.48999.7 MB 7.0% 284.35
Jul 14 05:00:00 - 05:59:59 1616 6.6% 0.45868.4 MB 6.1% 247.01
Jul 14 06:00:00 - 06:59:59 1600 6.6% 0.44937.0 MB 6.6% 266.53
Jul 14 07:00:00 - 07:59:59 2012 8.2% 0.561.2 GB 8.4% 339.83
Jul 14 08:00:00 - 08:59:59 1747 7.2% 0.49965.3 MB 6.8% 274.57
Jul 14 09:00:00 - 09:59:59 1738 7.1% 0.48868.8 MB 6.1% 247.12
Jul 14 10:00:00 - 10:59:59 1511 6.2% 0.42821.6 MB 5.8% 233.71
Jul 14 11:00:00 - 11:59:59 1483 6.1% 0.41882.5 MB 6.2% 251.01
Jul 14 12:00:00 - 12:59:59 1697 7.0% 0.471.0 GB 7.3% 293.52
Jul 14 13:00:00 - 13:59:59 1749 7.2% 0.491011.8 MB 7.1% 287.81
Jul 14 14:00:00 - 14:59:59 1933 7.9% 0.541.2 GB 8.4% 340.98
Jul 14 15:00:00 - 15:30:01 956 3.9% 0.53574.6 MB 4.0% 326.69
TOTAL: 14:30:00 24389 100.0% 0.4713.9 GB 100.0% 279.05
Incoming articles
Incoming articles (size)

Sites sending bad articles:

ServerTotalGroupDistDuplicUnappTooOldSiteLineOther
1newsfeed.bofh.team 52857 49854 0 748 4 0 793 0 1458
2nk-out.news.weretis.net 1144 43 0 1029 0 0 60 0 12
3feeder.erje.net 1106 256 0 566 1 0 171 0 112
4news.nntp4.net 902 62 0 637 2 0 35 0 166
5news.dne3.net 829 23 0 619 0 0 73 0 114
6newsfeed.endofthelinebbs.com 707 69 0 553 0 0 24 0 61
7news.sonologic.net 637 57 0 545 0 0 33 0 2
8nntp.club.cc.cmu.edu 629 91 0 468 0 0 48 0 22
9news.snarked.org 527 59 0 446 1 0 18 0 3
10news.quux.org 519 43 0 472 0 0 4 0 0
11news.corradoroberto.it 245 7 0 230 0 0 8 0 0
12nntp.comgw.net 207 10 0 167 0 0 8 0 22
13nk-out.news.chmurka.net 180 8 0 171 0 0 1 0 0
14news.trigofacile.com 34 3 0 31 0 0 0 0 0
15localhost 1 0 0 0 0 0 0 0 1
TOTAL: 15 60524 50585 0 6682 8 01276 0 1973

Unwanted newsgroups [Top 20]:

NewsgroupCount
alt.binaries.ninja.michelangelo 2700
alt.binaries.encrypted 2604
alt.binaries.backup 1271
alt.binaries.font 1177
alt.binaries.xylo 1068
alt.binaries.multimedia.anime.highspeed 1038
alt.binaries.fta 987
alt.binaries.astronomy 909
alt.binaries.echange-web 857
alt.binaries.erotica.sex 845
alt.binaries.erotica.erotica 821
alt.binaries.art-of-usenet 765
alt.binaries.nordic.password.protected 763
alt.binaries.storage 759
alt.binaries.nzb 756
alt.binaries.hdtv.x264 739
alt.binaries.ucc 731
alt.binaries.ftn 724
alt.binaries.wtfnzb.charlie 682
alt.binaries.wtfnzb.mike 670
TOTAL: 250 50585

Supposedly-moderated groups with unmoderated postings [Top 20]:

GroupsCount
alt.binaries.atari 4
christnet.bible 3
fr.sci.geosciences 1
TOTAL: 3 8

Unwanted sites in Path header field [Top 20]:

SiteCount
news.newsdemon.com 841
news.neodome.net 422
news.mixmin.net 13
TOTAL: 3 1276

Perl filter (innd) [Top 20]:

ReasonCount
[CF-OTHER] EMP (md5) 278
[CF-OTHER] Binary Image: misplaced jpg 208
[CF-OTHER] User-issued cancel 11
[CF-CROSSPOST] Too many newsgroups (meow) 4
[CF-BINARY-MIME] Binary: misplaced binary 1
[CF-OTHER] Binary Image: misplaced png 1
[CF-OTHER] HTML Multipart 1
TOTAL: 7 504

NoCeM on spool:

Issuer (type)NoticesBad PGPCancelSkipTotal
robot@pasdenom.info (spam2)18002222
robot@pasdenom.info (spam3)20066
robot@pasdenom.info (spam4)10011
TOTAL: 321002929

Miscellaneous innd events:

EventsCount
RCreader 1
TOTAL: 1 1

Miscellaneous innd statistics [Top 10]:

EventServerNumber
Bad command received
newsfeed.bofh.team 5374
TOTAL: 1 5374
Huge articles
newsfeed.bofh.team 1413
TOTAL: 1 1413
Including strange strings
newsfeed.bofh.team 5
nk-out.news.weretis.net 1
news.nntp4.net 1
feeder.erje.net 1
newsfeed.endofthelinebbs.com 1
TOTAL: 5 9
No colon-space in header field
newsfeed.bofh.team 1
TOTAL: 1 1
TOTAL: 4 6797

Outgoing feeds (innfeed) by articles:

ServerOfferedTakenRefusedRejectMissSpool%TookElapsed
1nntp.club.cc.cmu.edu 25235 21144 2810 202 0 16 83%14:27:16
2news.quux.org 3005 40 2965 0 0 0 1%14:25:27
3nk-in.news.weretis.net 3335 39 3294 0 0 0 1%14:25:27
4news.snarked.org 3027 38 2988 0 0 0 1%14:25:27
5nntp.comgw.net 3167 37 3127 0 0 0 1%14:25:27
6news.sonologic.net 3043 37 3000 5 0 0 1%14:25:27
7news.nntp4.net 2832 37 2794 0 0 0 1%14:25:27
8newsfeed.endofthelinebbs.com 4768 35 2953 5 0 0 0%14:25:27
9feeder.erje.net 2207 33 2170 4 0 0 1%14:32:47
10news.trigofacile.com 185 1 174 0 0 17 0%11:27:36
11news.corradoroberto.it 409 0 408 0 0 1 0%14:20:29
12aioe.org 0 0 0 0 0 3269 0%14:26:30
13chmurka.net 0 0 0 0 0 0 0%00:20:00
14de-l.enfer-du-nord.net 0 0 0 0 0 3325 0%14:26:30
15feed.le-studio75.com 0 0 0 0 0 24305 0%14:26:30
16hal-mli.net 0 0 0 0 0 0 0%14:26:30
17just2write2.myftp.org 0 0 0 0 0 3290 0%14:26:30
18mccarragher.com 0 0 0 0 0 3348 0%14:31:42
19nedknow-in.feed.uzoreto.com 0 0 0 0 0 24305 0%14:26:30
20neva.ru 0 0 0 0 0 3299 0%14:25:27
21news.albasani.net 0 0 0 0 0 3334 0%14:26:30
22news.buerger.net 0 0 0 0 0 3342 0%14:25:27
23news.dne3.net 0 0 0 0 0 0 0%00:20:00
24news.furie.co.uk 0 0 0 0 0 24305 0%14:26:30
25news.gabrix.ath.cx 0 0 0 0 0 3273 0%14:26:30
26news.hub.org 0 0 0 0 0 334 0%14:26:30
27news.iridiumlinux.org 0 0 0 0 0 1240 0%14:26:30
28news.ripco.com 0 0 0 0 0 3270 0%14:26:30
29news.spacesst.com 0 0 0 0 0 3334 0%14:26:30
30news.telesweet.net 0 0 0 0 0 3331 0%14:23:50
31news.ycache.com 0 0 0 0 0 3286 0%14:23:50
32newsfeed.bofh.team 0 0 0 0 0 3048 0%14:25:27
33newsfeed.fsmpi.rwth-aachen.de 0 0 0 0 0 3325 0%14:26:30
34newsfeed.news4us.nl 0 0 0 0 0 3325 0%14:26:30
35newsfeed.x-privat.org 0 0 0 0 0 3336 0%14:26:30
36newsfeed1.swip.net 0 0 0 0 0 0 0%14:26:30
37nyheter.lysator.liu.se 0 0 0 0 0 24305 0%14:26:30
38peer.alt119.net 0 0 0 0 0 3343 0%14:26:30
39sonarsouth.com 0 0 0 0 0 0 0%14:26:30
40tranquility.net 0 0 0 0 0 3334 0%14:26:30
41uca516916.inbound.news.uu.net 0 0 0 0 0 24266 0%14:25:11
42usenet.blueworldhosting.com 0 0 0 0 0 2777 0%14:23:05
TOTAL: 42 51213 21441 26683 216 0 185283 41%575:06:46
Outgoing feeds (innfeed) by articles

Outgoing feeds (innfeed) by volume:

ServerAcceptVolRejectVolTotalVolVolume/secVol/ArtElapsed
1nntp.club.cc.cmu.edu13.8 GB547.2 KB13.8 GB278.9 KB/s679.8 KB14:27:16
2news.quux.org292.5 KB0.0 KB292.5 KB0.0 KB/s7.3 KB14:25:27
3nk-in.news.weretis.net291.2 KB0.0 KB291.2 KB0.0 KB/s7.5 KB14:25:27
4news.snarked.org289.0 KB0.0 KB289.0 KB0.0 KB/s7.6 KB14:25:27
5nntp.comgw.net285.8 KB0.0 KB285.8 KB0.0 KB/s7.7 KB14:25:27
6news.nntp4.net283.4 KB0.0 KB283.4 KB0.0 KB/s7.7 KB14:25:27
7newsfeed.endofthelinebbs.com277.5 KB18.3 KB295.8 KB0.0 KB/s7.4 KB14:25:27
8news.sonologic.net247.8 KB46.1 KB293.9 KB0.0 KB/s7.0 KB14:25:27
9feeder.erje.net136.0 KB16.3 KB152.3 KB0.0 KB/s4.1 KB14:32:47
10news.trigofacile.com2.1 KB0.0 KB2.1 KB0.0 KB/s2.1 KB11:27:36
11aioe.org0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
12chmurka.net0.0 KB0.0 KB0.0 KB0.0 KB/s000:20:00
13de-l.enfer-du-nord.net0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
14feed.le-studio75.com0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
15hal-mli.net0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
16just2write2.myftp.org0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
17mccarragher.com0.0 KB0.0 KB0.0 KB0.0 KB/s014:31:42
18nedknow-in.feed.uzoreto.com0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
19neva.ru0.0 KB0.0 KB0.0 KB0.0 KB/s014:25:27
20news.albasani.net0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
21news.buerger.net0.0 KB0.0 KB0.0 KB0.0 KB/s014:25:27
22news.corradoroberto.it0.0 KB0.0 KB0.0 KB0.0 KB/s014:20:29
23news.dne3.net0.0 KB0.0 KB0.0 KB0.0 KB/s000:20:00
24news.furie.co.uk0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
25news.gabrix.ath.cx0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
26news.hub.org0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
27news.iridiumlinux.org0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
28news.ripco.com0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
29news.spacesst.com0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
30news.telesweet.net0.0 KB0.0 KB0.0 KB0.0 KB/s014:23:50
31news.ycache.com0.0 KB0.0 KB0.0 KB0.0 KB/s014:23:50
32newsfeed.bofh.team0.0 KB0.0 KB0.0 KB0.0 KB/s014:25:27
33newsfeed.fsmpi.rwth-aachen.de0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
34newsfeed.news4us.nl0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
35newsfeed.x-privat.org0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
36newsfeed1.swip.net0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
37nyheter.lysator.liu.se0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
38peer.alt119.net0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
39sonarsouth.com0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
40tranquility.net0.0 KB0.0 KB0.0 KB0.0 KB/s014:26:30
41uca516916.inbound.news.uu.net0.0 KB0.0 KB0.0 KB0.0 KB/s014:25:11
42usenet.blueworldhosting.com0.0 KB0.0 KB0.0 KB0.0 KB/s014:23:05
TOTAL: 4213.8 GB627.9 KB13.8 GB7.0 KB/s670.1 KB575:06:46
Outgoing feeds (innfeed) by volume

NNRP readership statistics [Top 100]:

SystemConnArtsSizeGroupsPostRejElapsed
1doctor.nl2k.ab.ca 53 4001.4 MB 58 37 2424:55:08
2uucp.nk.ca 2 10.7 KB 1 1 000:01:37
TOTAL: 2 55 4011.4 MB 59 38 2424:56:46

NNRP connection statistics (by domain) [Top 100]:

SystemConnArtsSizeGroupsPostRejElapsed
1*.nl2k.ab.ca 53 4001.4 MB 58 37 2424:55:08
2*.nk.ca 3 10.7 KB 1 1 000:01:37
3*.monitoring.internet-measurement.com 21 00.0 KB 0 0 000:00:12
4*.167.censys-scanner.com 10 00.0 KB 0 0 000:00:02
5*.66.censys-scanner.com 9 00.0 KB 0 0 000:00:21
TOTAL: 5 96 4011.4 MB 59 38 2424:57:23

NNRP total resource statistics [Top 20]:

SystemUser(ms)System(ms)Idle(ms)Elapsed
doctor.nl2k.ab.ca 6.729 11.473 0.000424:55:08
uucp.nk.ca 0.207 0.079 0.00000:01:37
159.186.132.66.censys-scanner.com 1.822 0.110 0.00000:00:16
91.195.132.66.censys-scanner.com 1.688 0.033 0.00000:00:05
r4-143-8f.monitoring.internet-measurement.com 0.233 0.008 0.00000:00:02
62.146.94.167.censys-scanner.com 2.341 0.064 0.00000:00:02
r4-216-d8.monitoring.internet-measurement.com 0.476 0.016 0.00000:00:01
r5-129-81.monitoring.internet-measurement.com 0.231 0.022 0.00000:00:01
r4-190-be.monitoring.internet-measurement.com 0.252 0.000 0.00000:00:00
r4-198-c6.monitoring.internet-measurement.com 0.244 0.008 0.00000:00:00
r5-196-c4.monitoring.internet-measurement.com 0.244 0.008 0.00000:00:00
r3-189-bd.monitoring.internet-measurement.com 0.250 0.000 0.00000:00:00
10.210.203.35.bc.googleusercontent.com 0.250 0.000 0.00000:00:00
r5-194-c2.monitoring.internet-measurement.com 0.225 0.016 0.00000:00:00
r5-215-d7.monitoring.internet-measurement.com 0.231 0.008 0.00000:00:00
221.211.203.35.bc.googleusercontent.com 0.144 0.052 0.00000:00:00
gallifrey.nk.ca 0.074 0.033 0.00000:00:00
53.146.94.167.censys-scanner.com 0.207 0.107 0.00000:00:00
azpdsskv2v8p.stretchoid.com 0.142 0.061 0.00000:00:00
r3-8-8.monitoring.internet-measurement.com 0.239 0.000 0.00000:00:00
TOTAL: 35 19.353 12.299 0.000424:57:25

Curious NNRP explorers [Top 20]:

SystemConn
62.146.94.167.censys-scanner.com 10
159.186.132.66.censys-scanner.com 8
91.195.132.66.censys-scanner.com 7
53.146.94.167.censys-scanner.com 3
221.211.203.35.bc.googleusercontent.com 2
azpdsskv2v8p.stretchoid.com 2
r4-216-d8.monitoring.internet-measurement.com 2
10.210.203.35.bc.googleusercontent.com 1
198.235.24.196 1
216.226.76.20 1
gallifrey.nk.ca 1
r3-185-b9.monitoring.internet-measurement.com 1
r3-186-ba.monitoring.internet-measurement.com 1
r3-189-bd.monitoring.internet-measurement.com 1
r3-4-4.monitoring.internet-measurement.com 1
r3-8-8.monitoring.internet-measurement.com 1
r4-10-a.monitoring.internet-measurement.com 1
r4-143-8f.monitoring.internet-measurement.com 1
r4-190-be.monitoring.internet-measurement.com 1
r4-193-c1.monitoring.internet-measurement.com 1
TOTAL: 36 63

NNRP no permission clients [Top 20]:

SystemConn
91.195.132.66.censys-scanner.com 4
53.146.94.167.censys-scanner.com 3
159.186.132.66.censys-scanner.com 2
221.211.203.35.bc.googleusercontent.com 2
azpdsskv2v8p.stretchoid.com 2
10.210.203.35.bc.googleusercontent.com 1
198.235.24.196 1
216.226.76.20 1
r3-189-bd.monitoring.internet-measurement.com 1
r4-190-be.monitoring.internet-measurement.com 1
r4-198-c6.monitoring.internet-measurement.com 1
r4-216-d8.monitoring.internet-measurement.com 1
r5-129-81.monitoring.internet-measurement.com 1
r5-196-c4.monitoring.internet-measurement.com 1
TOTAL: 14 22

NNRP gethostbyaddr failures [Top 20]:

SystemConn
? (can't getpeername) 7
TOTAL: 1 7

NNRP unrecognized commands (by host) [Top 20]:

SystemConn
doctor.nl2k.ab.ca 2
uucp.nk.ca 1
TOTAL: 2 3

NNRP unrecognized commands (by command) [Top 20]:

CommandCount
XTHREAD DBINIT 3
TOTAL: 1 3

NNRP client timeouts [Top 20]:

SystemConnPeer
doctor.nl2k.ab.ca 9 0
TOTAL: 1 9 0

Newsgroup request counts (by hierarchy) [Top 100]:

HierarchyCountPct
1rec 354 94.1%
2comp 12 3.2%
3alt 5 1.3%
4edm 3 0.8%
5news 2 0.5%
TOTAL: 5 376100.0%

Newsgroup request counts (by newsgroup) [Top 100]:

NewsgroupCount
1rec.arts.drwho 333
2rec.sport.soccer 17
3comp.lang.javascript 6
4comp.lang.c++ 4
5rec.arts.sf.fandom 4
6alt.christnet 3
7edm.news.stats 3
8alt.christnet.prayer 2
9comp.lang.c 2
10news.software.nntp 2
TOTAL: 10 376
innreport from INN 2.8.0 (20260714 snapshot) based on initial work (©) 1996-2001 by Fabien Tassin <fta@sofaraway.org> and enhanced by several contributors since then